Novus Biologicals
Manufacturer Code:NBP183231
Catalog # NBP183231
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: homeo box 2I homeo box B1 homeobox B1 Homeobox protein Hox-2I homeobox protein Hox-B1 HOX2 Hox-2.9 HOX2IMGC116844 MGC116843 MGC116845; Homeobox protein Hox-2I; Homeobox protein Hox-B1
Gene Aliases: HCFP3; Hox-2.9; HOX2; HOX2I; HOXB1
UniProt ID: (Human) P14653
Entrez Gene ID: (Human) 3211
Molecular Function: DNA binding protein helix-turn-helix transcription factor homeobox transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.