Novus Biologicals
Manufacturer Code:NBP183234
Catalog # NBP183234
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: homeo box 1E; homeo box A3; homeo box A3 homeobox A3 Homeobox protein Hox-1E homeobox protein Hox-A3 HOX1 Hox-1.5-like protein HOX1Ehomeo box 1E MGC10155; Homeobox protein Hox-1E; Homeobox protein Hox-A3; Hox-1.5-like protein
Gene Aliases: HOX1; HOX1E; HOXA3
UniProt ID: (Human) O43365
Entrez Gene ID: (Human) 3200
Molecular Function:
DNA binding protein
helix-turn-helix transcription factor
homeobox transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.