Novus Biologicals
Manufacturer Code:NBP258894
Catalog # NBP258894
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: homeo box 1I; homeo box A11 homeobox A11 Homeobox protein Hox-1I homeobox protein Hox-A11 homeobox protein HOXA11 HOX1 HOX1Ihomeo box 1I; Homeobox protein Hox-1I; Homeobox protein Hox-A11; homeobox protein HOXA11
Gene Aliases: HOX1; HOX1I; HOXA11; RUSAT1
UniProt ID: (Human) P31270
Entrez Gene ID: (Human) 3207
Molecular Function:
DNA binding protein
helix-turn-helix transcription factor
homeobox transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.