Novus Biologicals
Manufacturer Code:NBP254973
Catalog # NBP254973
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cancer/testis antigen 46; Cancer/testis antigen 46 CT46DKFZP434A1315 HORMA domain containing 1 HORMA domain-containing protein 1 Newborn ovary HORMA protein NOHMADKFZp434A1315; CT46; HORMA domain-containing protein 1; Newborn ovary HORMA protein; testis tissue sperm-binding protein Li 86P
Gene Aliases: CT46; HORMAD1; NOHMA
UniProt ID: (Human) Q86X24
Entrez Gene ID: (Human) 84072
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.