Novus Biologicals
Manufacturer Code:NBP214097
Catalog # NBP214097
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQ VGADAAMVVTPCYYRGRMSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4-hydroxy-2-oxoglutarate aldolase 1 C10orf65 chromosome 10 open reading frame 65 DHDPS2 DHDPSLHP3 DHDPS-like protein Dihydrodipicolinate synthase-like dihydrodipicolinate synthase-like mitochondrial dihydrodipicolinate synthetase homolog 2 EC 4.1.3.16 FLJ37472 FLJ56960 N-acetylneuraminate pyruvate lyase 2 (putative) NPL2 Probable 2-keto-4-hydroxyglutarate aldolase probable 4-hydroxy-2-oxoglutarate aldolase mitochondrial Probable KHG-aldolase Protein 569272; 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; DHDPS-like protein; Dihydrodipicolinate synthase-like; dihydrodipicolinate synthase-like, mitochondrial; dihydrodipicolinate synthetase homolog 2; N-acetylneuraminate pyruvate lyase 2 (putative); Probable 2-keto-4-hydroxyglutarate aldolase; probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; Probable KHG-aldolase; Protein 569272
Gene Aliases: C10orf65; DHDPS2; DHDPSL; HOGA1; HP3; NPL2
UniProt ID: (Human) Q86XE5
Entrez Gene ID: (Human) 112817
Molecular Function:
lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.