Novus Biologicals
Manufacturer Code:NBP257441
Catalog # NBP257441
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: H6 family homeobox 3 homeo box (H6 family) 3 homeobox (H6 family) 3 Homeobox protein H6 family member 3 homeobox protein HMX3 Homeobox protein Nkx-5.1 NKX5.1 NKX-5.1 NKX5-1; homeo box (H6 family) 3; homeobox (H6 family) 3; Homeobox protein H6 family member 3; Homeobox protein HMX3; Homeobox protein Nkx-5.1
Gene Aliases: HMX3; NKX-5.1; NKX5-1; NKX5.1
UniProt ID: (Human) A6NHT5
Entrez Gene ID: (Human) 340784
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.