Novus Biologicals
Manufacturer Code:NBP15683320UL
Catalog # NBP15683320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HMGCLL1(3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1) The peptide sequence was selected from the N terminal of HMGCLL1. Peptide sequence MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1; 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1 bA418P12.13-hydroxymethyl-3-methylglutaryl-CoA lyase-like protein 1 DKFZp434G1411 DKFZP434G14113-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1 EC 4.1.3.4 probable 3-hydroxymethyl-3-methylglutaryl-CoA lyase 2; 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like protein 1; 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; endoplasmic reticulum 3-hydroxymethyl-3-methylglutaryl-CoA lyase; er-cHL; HMGCL-like 1; probable 3-hydroxymethyl-3-methylglutaryl-CoA lyase 2
Gene Aliases: bA418P12.1; er-cHL; HMGCLL1
UniProt ID: (Human) Q8TB92
Entrez Gene ID: (Human) 54511
Molecular Function:
lyase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.