Novus Biologicals
Manufacturer Code:NBP157277
Catalog # NBP157277
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HRB(HIV-1 Rev binding protein) The peptide sequence was selected from the middle region of HRB. Peptide sequence SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Arf-GAP domain and FG repeat-containing protein 1; arf-GAP domain and FG repeats-containing protein 1; ArfGAP with FG repeats 1 DKFZp686I15205 HIV-1 Rev-binding protein HRBRev interacting protein Rab Rev/Rex activation domain-binding protein RABMGC116938 RIPMGC116940; HIV-1 Rev binding protein; HIV-1 Rev-binding protein; hRIP, Rev interacting protein; Nucleoporin-like protein RIP; Rab, Rev/Rex activation domain-binding protein; Rev-interacting protein; Rev/Rex activation domain-binding protein
Gene Aliases: AGFG1; HRB; RAB; RIP
UniProt ID: (Human) P52594
Entrez Gene ID: (Human) 3267
Molecular Function:
G-protein modulator
enzyme modulator
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.