Novus Biologicals
Manufacturer Code:NBP189693
Catalog # NBP189693
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Diphosphoinositol pentakisphosphate kinase 1; diphosphoinositol pentakisphosphate kinase 1 histidine acid phosphatase domain-containing protein 2A inositol pyrophosphate synthase 1 VIP1; histidine acid phosphatase domain containing 2A; Histidine acid phosphatase domain-containing protein 2A; hsVIP1; Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1; Inositol pyrophosphate synthase 1; InsP6 and PP-IP5 kinase 1; IP6 kinase; VIP1 homolog
Gene Aliases: HISPPD2A; hsVIP1; IP6K; IPS1; KIAA0377; PPIP5K1; VIP1
UniProt ID: (Human) Q6PFW1
Entrez Gene ID: (Human) 9677
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.