Novus Biologicals
Manufacturer Code:NBP15464220UL
Catalog # NBP15464220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Diphosphoinositol pentakisphosphate kinase 2; diphosphoinositol pentakisphosphate kinase 2FLJ21506 EC 2.7.4.21 EC 2.7.4.24 HISPPD1histidine acid phosphatase domain containing 1 Histidine acid phosphatase domain-containing protein 1 hsVIP2 inositol heptaphosphate kinase 2 inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 InsP6 and PP-IP5 kinase 2 KIAA0433FLJ23463 VIP1 homolog 2 VIP2IP7K2; Histidine acid phosphatase domain-containing protein 1; hsVIP2; inositol heptaphosphate kinase 2; Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2; InsP6 and PP-IP5 kinase 2; VIP1 homolog 2
Gene Aliases: CFAP160; HISPPD1; IP7K2; KIAA0433; PPIP5K2; VIP2
UniProt ID: (Human) O43314
Entrez Gene ID: (Human) 23262
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.