Novus Biologicals
Manufacturer Code:NBP276564
Catalog # NBP276564
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This HIF-2 alpha/EPAS1 Antibody was developed against Recombinant Protein corresponding to amino acids: EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
Protein Aliases: Basic-helix-loop-helix-PAS protein MOP2; Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 Class E basic helix-loop-helix protein 73 ECYT4 endothelial PAS domain protein 1 endothelial PAS domain-containing protein 1 EPAS1 EPAS-1 HIF-1-alpha-like factor HIF-1alpha-like factor HIF-2 alpha; bHLHe73; Class E basic helix-loop-helix protein 73; Endothelial PAS domain-containing protein 1; EPAS-1; HIF-1-alpha-like factor; HIF-1alpha-like factor; HIF-2-alpha; HIF2-alpha; HLF; hypoxia-inducible factor 2 alpha; Hypoxia-inducible factor 2-alpha; Member of PAS protein 2; PAS domain-containing protein 2
Gene Aliases: BHLHE73; ECYT4; EPAS1; HIF2A; HLF; MOP2; PASD2
UniProt ID: (Human) Q99814
Entrez Gene ID: (Human) 2034
Molecular Function:
basic helix-loop-helix transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.