Novus Biologicals
Manufacturer Code:NBP17977720UL
Catalog # NBP17977720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human HHIPL1The immunogen for this antibody is HHIPL1 (NP_001120730). Peptide sequence EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARAR9245; ARAR9245 HHIP-like 1 HHIP-like protein 1 KIAA1822; HHIP-like protein 1
Gene Aliases: HHIP2; HHIPL1; KIAA1822; UNQ9245; UNQ9245/PRO34761
UniProt ID: (Human) Q96JK4
Entrez Gene ID: (Human) 84439
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.