Novus Biologicals
Manufacturer Code:NBP169465
Catalog # NBP169465
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HHAT(hedgehog acyltransferase) The peptide sequence was selected from the N terminal of human HHAT (NP_060664). Peptide sequence MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.3.1.- FLJ10724 FLJ34867 GUP2 hedgehog acyltransferaserasp MART-2 MART2sit melanoma antigen recognized by T cells 2 Melanoma antigen recognized by T-cells 2 protein-cysteine N-palmitoyltransferase HHAT SKI1ski Skinny hedgehog protein 1 Skn; Hedgehog acyltransferase; MART-2; melanoma antigen recognized by T cells 2; Melanoma antigen recognized by T-cells 2; Protein-cysteine N-palmitoyltransferase HHAT; Skinny hedgehog protein 1
Gene Aliases: HHAT; MART2; SKI1; Skn
UniProt ID: (Human) Q5VTY9
Entrez Gene ID: (Human) 55733
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.