Novus Biologicals
Manufacturer Code:NBP15905420UL
Catalog # NBP15905420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ221C16.10.1 hemochromatosis hereditary hemochromatosis protein hereditary hemochromatosis protein HLA-H HH high Fe HLAH HLA-HHFE1 MGC103790 MHC class I-like protein HFE MVCD7; Hereditary hemochromatosis protein; hereditary hemochromatosis protein HLA-H; high Fe; HLA-H; MHC class I-like protein HFE
Gene Aliases: HFE; HFE1; HH; HLA-H; HLAH; MVCD7; TFQTL2
UniProt ID: (Human) Q30201
Entrez Gene ID: (Human) 3077
Molecular Function:
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
major histocompatibility complex antigen
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.