Novus Biologicals
Manufacturer Code:NBP238756
Catalog # NBP238756
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3' exoribonuclease; 3' exoribonuclease 3'-5' exonuclease ERI1 3'EXO 3'HEXO EC 3.1 enhanced RNAi three prime mRNA exonuclease homolog 1 Eri-1 homolog exoribonuclease 1 HEXO histone mRNA 3' end-specific exonuclease Histone mRNA 3'-end-specific exoribonuclease Histone mRNA 3'-exonuclease 1 MGC35395 Protein 3'hExo THEX1 three prime histone mRNA exonuclease 13'-5' exoribonuclease 1 three prime mRNA exonuclease 1; 3'-5' exonuclease ERI1; 3'-5' exoribonuclease 1; enhanced RNAi three prime mRNA exonuclease homolog 1; Eri-1 homolog; HEXO; histone mRNA 3' end-specific exonuclease; Histone mRNA 3'-end-specific exoribonuclease; Histone mRNA 3'-exonuclease 1; Protein 3'hExo; three prime histone mRNA exonuclease 1; three prime mRNA exonuclease 1
Gene Aliases: 3'EXO; 3'HEXO; ERI1; HEXO; THEX1
UniProt ID: (Human) Q8IV48
Entrez Gene ID: (Human) 90459
Molecular Function: RNA binding protein esterase exoribonuclease hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.