Novus Biologicals
Manufacturer Code:NBP179231
Catalog # NBP179231
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human NCKAP1L. Peptide sequence LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Hematopoietic protein 1; Hematopoietic protein 1HEM1Membrane-associated protein HEM-1 NCK-associated protein 1-like; Membrane-associated protein HEM-1; Nck-associated protein 1-like
Gene Aliases: HEM1; NCKAP1L
UniProt ID: (Human) P55160
Entrez Gene ID: (Human) 3071
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.