Novus Biologicals
Manufacturer Code:NBP182684
Catalog # NBP182684
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (ppGpp)ase; (ppGpp)ase EC 3.1.7.2 guanosine-3'-5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 HD domain containing 3 HD domain-containing protein 3 MESH1 Metazoan SpoT homolog 1 metazoan SpoT homolog-1 MGC45386 Penta-phosphate guanosine-3'-pyrophosphohydrolase; Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1; HD domain-containing protein 3; MESH1; Metazoan SpoT homolog 1; Penta-phosphate guanosine-3'-pyrophosphohydrolase
Gene Aliases: (ppGpp)ase; HDDC3; MESH1
UniProt ID: (Human) Q8N4P3
Entrez Gene ID: (Human) 374659
Molecular Function:
hydrolase
pyrophosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.