Novus Biologicals
Manufacturer Code:NBP153103
Catalog # NBP153103
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HBXIP(hepatitis B virus x interacting protein) The peptide sequence was selected from the N terminal of HBXIP. Peptide sequence EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HBV X-interacting protein; HBV X-interacting protein HBX-interacting protein hepatitis B virus x interacting protein hepatitis B virus x-interacting protein (9.6kD) MGC71071 XIPhepatitis B virus X-interacting protein; HBx-interacting protein; hepatitis B virus x interacting protein; Hepatitis B virus X-interacting protein; hepatitis B virus x-interacting protein (9.6kD); Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5; Ragulator complex protein LAMTOR5
Gene Aliases: HBXIP; LAMTOR5; XIP
UniProt ID: (Human) O43504
Entrez Gene ID: (Human) 10542
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.