Novus Biologicals
Manufacturer Code:NBP153164
Catalog # NBP153164
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HAO2(hydroxyacid oxidase 2 (long chain)) The peptide sequence was selected from the N terminal of HAO2. Peptide sequence DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (S)-2-hydroxy-acid oxidase peroxisomal Cell growth-inhibiting gene 16 protein EC 1.1.3.15 GIG16 growth-inhibiting protein 16 HAOX2glycolate oxidase hydroxyacid oxidase 2 hydroxyacid oxidase 2 (long chain) Long chain alpha-hydroxy acid oxidase Long-chain L-2-hydroxy acid oxidase; (S)-2-hydroxy-acid oxidase, peroxisomal; Cell growth-inhibiting gene 16 protein; glycolate oxidase; HAOX2; Hydroxyacid oxidase 2; hydroxyacid oxidase 2 (long chain); Long chain alpha-hydroxy acid oxidase; Long-chain L-2-hydroxy acid oxidase
Gene Aliases: GIG16; HAO2; HAOX2
UniProt ID: (Human) Q9NYQ3
Entrez Gene ID: (Human) 51179
Molecular Function:
dehydrogenase
isomerase
ligase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.