Novus Biologicals
Manufacturer Code:NBP17418520UL
Catalog # NBP17418520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: basic helix-loop-helix transcription factor HAND2; bHLHa26; BHLHA26 bHLHa26MGC125303 dHAND DHAND2 FLJ16260 heart and neural crest derivatives expressed 2 heart autonomic nervous system and neural crestderivatives-expressed protein 2 Hed MGC125304 Thing2; Class A basic helix-loop-helix protein 26; Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; dHAND; Heart- and neural crest derivatives-expressed protein 2
Gene Aliases: BHLHA26; DHAND; DHAND2; HAND2; Hed; Thing2
UniProt ID: (Human) P61296
Entrez Gene ID: (Human) 9464
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.