Novus Biologicals
Manufacturer Code:NBP182609
Catalog # NBP182609
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-enoyl-Coenzyme A (CoA) hydratase beta subunit 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein acetyl-CoA acyltransferase beta subunit beta-ketothiolase EC 2.3.1 EC 2.3.1.16 ECHB hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein) beta subunit hydroxyacyl-Coenzyme A (CoA) dehydrogenase beta subunit hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein) beta subunit MGC87480 mitochondrial trifunctional enzyme beta subunit mitochondrial trifunctional protein beta subunit MTPB TP-beta trifunctional enzyme subunit beta mitochondrial; 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit; 3-ketoacyl-CoA thiolase; 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, beta subunit; Acetyl-CoA acyltransferase; Beta-ketothiolase; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit; TP-beta; Trifunctional enzyme subunit beta, mitochondrial
Gene Aliases: ECHB; HADHB; MSTP029; MTPB; TP-BETA
UniProt ID: (Human) O14969
Entrez Gene ID: (Human) 3032
Molecular Function: acetyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.