Novus Biologicals
Manufacturer Code:NBP254988
Catalog # NBP254988
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-ketoacyl-Coenzyme A (CoA) thiolase alpha subunit 3-oxoacyl-CoA thiolase 78 kDa gastrin-binding protein ECHA gastrin-binding protein GBP HADH hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein) alpha subunit hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein) alpha subunit LCEH LCHAD long-chain 2-enoyl-CoA hydratase long-chain-3-hydroxyacyl-CoA dehydrogenase MGC1728 mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase alpha subunit mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase alphasubunit mitochondrial trifunctional enzyme alpha subunit mitochondrial trifunctional protein alpha subunit MTPATP-ALPHA TP-alpha trifunctional enzyme subunit alpha mitochondrial; 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit; 3-oxoacyl-CoA thiolase; 78 kDa gastrin-binding protein; gastrin-binding protein; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit; Long chain 3-hydroxyacyl-CoA dehydrogenase; long-chain 2-enoyl-CoA hydratase; Long-chain enoyl-CoA hydratase; long-chain-3-hydroxyacyl-CoA dehydrogenase; mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit; mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alpha subunit; mitochondrial trifunctional enzyme, alpha subunit; mitochondrial trifunctional protein, alpha subunit; Monolysocardiolipin acyltransferase; TP-alpha; Trifunctional enzyme subunit alpha, mitochondrial
Gene Aliases: ECHA; GBP; HADH; HADHA; LCEH; LCHAD; MTPA; TP-ALPHA
UniProt ID: (Human) P40939
Entrez Gene ID: (Human) 3030
Molecular Function: dehydrogenase epimerase/racemase hydratase isomerase lyase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.