Novus Biologicals
Manufacturer Code:NBP189790
Catalog # NBP189790
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ASF/SF2-associated protein p32; C1q globular domain-binding protein; C1q globular domain-binding protein C1qBP complement component 1 Q subcomponent-binding protein mitochondrial complement component 1 q subcomponent binding protein GC1QBP gC1qR gC1Q-R GC1q-R protein Glycoprotein gC1qBP HABP1p33 Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p32 SF2P32 splicing factor SF2-associated protein; C1qBP; Complement component 1 Q subcomponent-binding protein, mitochondrial; complement component 1, q subcomponent binding protein; gC1q-R protein; Glycoprotein gC1qBP; Hyaluronan-binding protein 1; Mitochondrial matrix protein p32; p33; SF2AP32; splicing factor SF2-associated protein
Gene Aliases: C1QBP; gC1Q-R; GC1QBP; gC1qR; HABP1; p32; SF2P32
UniProt ID: (Human) Q07021
Entrez Gene ID: (Human) 708
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.