Novus Biologicals
Manufacturer Code:NBP276521
Catalog # NBP276521
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
Protein Aliases: ATP:GMP phosphotransferase; EC 2.7.4.8 FLJ42686 FLJ43710 GMK GMP kinase guanylate kinase guanylate kinase 1; GMP kinase; Guanylate kinase; Guanylate kinase 1
Gene Aliases: GMK; GMPK; GUK1
UniProt ID: (Human) Q16774
Entrez Gene ID: (Human) 2987
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.