Novus Biologicals
Manufacturer Code:NBP169449
Catalog # NBP169449
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GHR(growth hormone receptor) The peptide sequence was selected from the N terminal of Growth hormone receptor. Peptide sequence LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GH receptor; GH receptor GHBP growth hormone binding protein growth hormone receptor serum binding protein Somatotropin receptor; GH-binding protein; growth hormone binding protein; Growth hormone receptor; Growth hormone-binding protein; serum binding protein; Serum-binding protein; Somatotropin receptor
Gene Aliases: GHBP; GHIP; GHR
UniProt ID: (Human) P10912
Entrez Gene ID: (Human) 2690
Molecular Function:
cytokine
defense/immunity protein
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.