Novus Biologicals
Manufacturer Code:NBP158993
Catalog # NBP158993
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GZMA(granzyme A (granzyme 1 cytotoxic T-lymphocyte-associated serine esterase 3)) The peptide sequence was selected from the middle region of GZMA (NP_006135). Peptide sequence TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CTL tryptase; CTL tryptase CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3 Hanukah factorserine protease) Cytotoxic T-lymphocyte proteinase 1 EC 3.4.21 fragmentin-1 granzyme A granzyme A (granzyme 1 cytotoxic T-lymphocyte-associated serine esterase 3) Granzyme-1 H factor Hanukkah factor HF HFSPEC 3.4.21.78; Cytotoxic T-lymphocyte proteinase 1; Cytotoxic T-lymphocyte-associated serine esterase-3; Fragmentin-1; granzyme 1; Granzyme A; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); Granzyme-1; H factor; Hanukah factor serine protease); Hanukkah factor; HF
Gene Aliases: CTLA3; GZMA; HFSP
UniProt ID: (Human) P12544
Entrez Gene ID: (Human) 3001
Molecular Function: annexin calcium-binding protein calmodulin enzyme modulator hydrolase intracellular calcium-sensing protein peptide hormone protease protease inhibitor receptor serine protease signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.