Novus Biologicals
Manufacturer Code:NBP15667420UL
Catalog # NBP15667420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HAGH(hydroxyacylglutathione hydrolase) The peptide sequence was selected from the C terminal of HAGH. Peptide sequence FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.2.6 GLO2hydroxyacyl glutathione hydrolase Glx II GLXII Glyoxalase II HAGH1GLX2 hydroxyacylglutathione hydrolase hydroxyacylglutathione hydrolase mitochondrial hydroxyacylglutathione hydroxylase; Glx II; Glyoxalase II; Hydroxyacylglutathione hydrolase, mitochondrial; hydroxyacylglutathione hydroxylase
Gene Aliases: GLO2; GLX2; GLXII; HAGH; HAGH1
UniProt ID: (Human) Q16775
Entrez Gene ID: (Human) 3029
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.