Novus Biologicals
Manufacturer Code:NBP17929120UL
Catalog # NBP1792920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human Gyg. Peptide sequence SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.1.186 glycogenin glycogenin 1 glycogenin-1 GN1 GN-1 GSD15 GYG; glycogenin glucosyltransferase; Glycogenin-1; GN-1
Gene Aliases: GSD15; GYG; GYG1
UniProt ID: (Human) P46976
Entrez Gene ID: (Human) 2992
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.