Novus Biologicals
Manufacturer Code:NBP15533220UL
Catalog # NBP15533220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GPD1(glycerol-3-phosphate dehydrogenase 1 (soluble)) The peptide sequence was selected from the middle region of GPD1. Peptide sequence TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1 EC 1.1.1.8 FLJ26652 glycerol-3-phosphate dehydrogenase [NAD+] cytoplasmic glycerol-3-phosphate dehydrogenase 1 (soluble) glycerol-3-phosphate dehydrogenase soluble GPD-C GPDH-C; glycerol-3-phosphate dehydrogenase 1 (soluble); Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; glycerophosphate dehydrogenase; GPD-C
Gene Aliases: GPD-C; GPD1; GPDH-C; HTGTI
UniProt ID: (Human) P21695
Entrez Gene ID: (Human) 2819
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.