Novus Biologicals
Manufacturer Code:NBP179689
Catalog # NBP179689
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human GLRX2. Peptide sequence NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2) glutaredoxin 2 glutaredoxin-2 mitochondrial GRX2bA101E13.1; glutaredoxin (thioltransferase) 2; Glutaredoxin-2, mitochondrial
Gene Aliases: CGI-133; GLRX2; GRX2
UniProt ID: (Human) Q9NS18
Entrez Gene ID: (Human) 51022
Molecular Function:
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.