Novus Biologicals
Manufacturer Code:NBP156684
Catalog # NBP156684
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLRX(glutaredoxin (thioltransferase)) The peptide sequence was selected from the N terminal of GLRX. Peptide sequence IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: glutaredoxin (thioltransferase); glutaredoxin (thioltransferase) glutaredoxin-1 GRXGRX1 MGC117407 Thioltransferase-1 TTase-1; Glutaredoxin-1; thioltransferase; Thioltransferase-1; TTase-1
Gene Aliases: GLRX; GRX; GRX1
UniProt ID: (Human) P35754
Entrez Gene ID: (Human) 2745
Molecular Function: oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.