Novus Biologicals
Manufacturer Code:NBP189766
Catalog # NBP189766
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAD20 EC 3.5.1.2 GLS1DKFZp686O15119 glutaminase glutaminase C glutaminase kidney isoform mitochondrial glutaminase phosphate-activated K-glutaminase KIAA0838FLJ10358 L-glutamine amidohydrolase; GLS; glutaminase C; Glutaminase kidney isoform, mitochondrial; Glutaminase kidney isoform, mitochondrial 65 kDa chain; Glutaminase kidney isoform, mitochondrial 68 kDa chain; glutaminase, phosphate-activated; K-glutaminase; L-glutamine amidohydrolase
Gene Aliases: AAD20; GAC; GAM; GLS; GLS1; KGA; KIAA0838
UniProt ID: (Human) O94925
Entrez Gene ID: (Human) 2744
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.