Novus Biologicals
Manufacturer Code:NBP154961
Catalog # NBP154961
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1. Peptide sequence EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.4.1 EC 1.4.1.3 GDH GDH 1 GDH1 GLUD glutamate dehydrogenase (NAD(P)+) glutamate dehydrogenase 1 glutamate dehydrogenase 1 mitochondrial MGC132003; epididymis tissue sperm binding protein Li 18mP; GDH 1; glutamate dehydrogenase (NAD(P)+); Glutamate dehydrogenase 1, mitochondrial
Gene Aliases: GDH; GDH1; GLUD; GLUD1
UniProt ID: (Human) P00367
Entrez Gene ID: (Human) 2746
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.