Novus Biologicals
Manufacturer Code:NBP155437
Catalog # NBP155437
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GLUD2(glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2. Peptide sequence MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.4.1 EC 1.4.1.3 GDH 2 GDH2 GLUDP1 glutamate dehydrogenase 2 glutamate dehydrogenase 2 mitochondrial glutamate dehydrogenase pseudogene 1; GDH 2; Glutamate dehydrogenase 2, mitochondrial; glutamate dehydrogenase pseudogene 1; testicular secretory protein Li 14
Gene Aliases: GDH2; GLUD2; GLUDP1
UniProt ID: (Human) P49448
Entrez Gene ID: (Human) 2747
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.