Novus Biologicals
Manufacturer Code:NBP159812
Catalog # NBP159812
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter) member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Glucose transporter type 8; Glucose transporter type X1; GLUT-8; GLUT-8 GLUT8solute carrier family 2 (facilitated glucose transporter) member 8 GLUTX1facilitated glucose transporter member 8 solute carrier family 2 (facilitated glucose transporter) member 8; solute carrier family 2 (facilitated glucose transporter), member 8; Solute carrier family 2, facilitated glucose transporter member 8
Gene Aliases: GLUT8; GLUTX1; SLC2A8
UniProt ID: (Human) Q9NY64
Entrez Gene ID: (Human) 29988
Molecular Function:
carbohydrate transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.