Novus Biologicals
Manufacturer Code:NBP159891AF750
Catalog # NP19891A70
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter) member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT |
Conjugate | Alexa Fluor 750 |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C in the dark. |
Rabbit Polyclonal Antibody
Protein Aliases: Glucose transporter type 6; Glucose transporter type 6 Glucose transporter type 9 GLUT6 GLUT-9 GLUT9GLUT-6 HSA011372 solute carrier family 2 (facilitated glucose transporter) member 6 solute carrier family 2 facilitated glucose transporter member 6; glucose transporter type 9; GLUT-6; GLUT-9; solute carrier family 2 (facilitated glucose transporter), member 6; Solute carrier family 2, facilitated glucose transporter member 6
Gene Aliases: GLUT6; GLUT9; HSA011372; SLC2A6
UniProt ID: (Human) Q5SXD7
Entrez Gene ID: (Human) 11182
Molecular Function:
carbohydrate transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.