Novus Biologicals
Manufacturer Code:NBP238329
Catalog # NBP238329
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Glicentin; Glicentin-related polypeptide; glicentin-related polypeptide GLP1 GLP-1 glucagon glucagon-like peptide 1 glucagon-like peptide 2 GRPP; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP-2; Glucagon; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; GRPP; Incretin hormone; OXM; Oxyntomodulin; preproglucagon; Pro-glucagon
Gene Aliases: GCG; GLP1; GLP2; GRPP
UniProt ID: (Human) P01275
Entrez Gene ID: (Human) 2641
Molecular Function:
peptide hormone
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.