Novus Biologicals
Manufacturer Code:NBP189773
Catalog # NBP189773
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Appetite-regulating hormone; appetite-regulating hormone ghrelin ghrelin/obestatin preprohormone ghrelin/obestatin prepropeptide Growth hormone secretagogue Growth hormone-releasing peptide Motilin-related peptide MTLRPgrowth hormone secretagogue receptor ligand obestatin Protein M46; Ghrelin; ghrelin, growth hormone secretagogue receptor ligand; Ghrelin-27; Ghrelin-28; ghrelin/obestatin preprohormone; Growth hormone secretagogue; Growth hormone-releasing peptide; In2c-preproghrelin; Motilin-related peptide; Obestatin; prepro-appetite regulatory hormone; preproghrelin; Protein M46
Gene Aliases: GHRL; MTLRP; UNQ524/PRO1066
UniProt ID: (Human) Q9UBU3
Entrez Gene ID: (Human) 51738
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.