Novus Biologicals
Manufacturer Code:NBP258947
Catalog # NBP258947
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adapter-related protein complex 1 subunit gamma-1; Adapter-related protein complex 1 subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 adaptor-related protein complex 1 gamma 1 subunit ADTGclathrin assembly protein complex 1 gamma large chain AP-1 complex subunit gamma-1 CLAPG1clathrin-associated/assembly/adaptor protein large gamma 1 Clathrin assembly protein complex 1 gamma-1 large chain gamma adaptin gamma1-adaptin golgi adaptor HA1/AP1 adaptin gamma subunit Golgi adaptor HA1/AP1 adaptin subunit gamma-1 MGC18255; Adaptor protein complex AP-1 subunit gamma-1; adaptor-related protein complex 1 gamma 1 subunit; Adaptor-related protein complex 1 subunit gamma-1; adaptor-related protein complex 1, gamma 1 subunit; AP-1 complex subunit gamma-1; clathrin assembly protein complex 1 gamma large chain; Clathrin assembly protein complex 1 gamma-1 large chain; clathrin-associated/assembly/adaptor protein, large, gamma 1; gamma adaptin; Gamma1-adaptin; golgi adaptor HA1/AP1 adaptin gamma subunit; Golgi adaptor HA1/AP1 adaptin subunit gamma-1; testicular tissue protein Li 21
Gene Aliases: ADTG; AP1G1; CLAPG1
UniProt ID: (Human) O43747
Entrez Gene ID: (Human) 164
Molecular Function: transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.