Novus Biologicals
Manufacturer Code:NBP155137
Catalog # NBP155137
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.5.1.18 EC 5.2.1.2 glutathione S-alkyltransferase glutathione S-aralkyltransferase Glutathione S-transferase zeta 1 glutathione transferase zeta 1 GSTZ1-1maleylacetoacetate isomerase MAAIglutathione S-aryltransferase MAI maleylacetone isomerase MGC2029 S-(hydroxyalkyl)glutathione lyase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; Glutathione S-transferase zeta 1; glutathione transferase zeta 1; GSTZ1-1; MAAI; Maleylacetoacetate isomerase; maleylacetone isomerase; S-(hydroxyalkyl)glutathione lyase
Gene Aliases: GSTZ1; GSTZ1-1; MAAI; MAI
UniProt ID: (Human) O43708
Entrez Gene ID: (Human) 2954
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.