Novus Biologicals
Manufacturer Code:NBP154580
Catalog # NBP154580
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GSTO2(glutathione S-transferase omega 2) The peptide sequence was selected from the N terminal of GSTO2. Peptide sequence VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA127L20.1 (novel glutathione-S-transferase); bA127L20.1 bA127L20.1 (novel glutathione-S-transferase) EC 2.5.1.18 glutathione S-transferase omega 2 glutathione S-transferase omega-2 glutathione-S-transferase-like protein GSTO-2; Glutathione S-transferase omega 2-2; Glutathione S-transferase omega-2; Glutathione-dependent dehydroascorbate reductase; glutathione-S-transferase-like protein; GSTO 2-2; GSTO-2; MMA(V) reductase; Monomethylarsonic acid reductase
Gene Aliases: bA127L20.1; GSTO 2-2; GSTO2
UniProt ID: (Human) B4DJW6
Entrez Gene ID: (Human) 119391
Molecular Function: RNA binding protein cytoskeletal protein epimerase/racemase isomerase nucleic acid binding oxidoreductase reductase signaling molecule transferase translation elongation factor translation factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.