Novus Biologicals
Manufacturer Code:NBP232691
Catalog # NBP232691
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp686H13163 EC 2.5.1.18 glutathione S-transferase omega 1 glutathione S-transferase omega 1-1 glutathione S-transferase omega-1 glutathione-S-transferase like GSTO-1 GSTTLp28 P28; epididymis secretory protein Li 21; Glutathione S-transferase omega 1-1; Glutathione S-transferase omega-1; Glutathione-dependent dehydroascorbate reductase; glutathione-S-transferase like; GSTO 1-1; GSTO-1; MMA(V) reductase; Monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; SPG-R
Gene Aliases: GSTO 1-1; GSTO1; GSTTLP28; HEL-S-21; P28; SPG-R
UniProt ID: (Human) P78417
Entrez Gene ID: (Human) 9446
Molecular Function: RNA binding protein cytoskeletal protein epimerase/racemase isomerase nucleic acid binding oxidoreductase reductase signaling molecule transferase translation elongation factor translation factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.