Novus Biologicals
Manufacturer Code:NBP183323
Catalog # NBP183323
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: brain GST; brain type mu-glutathione S-transferase; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; glutathione S-aryltransferase M3; glutathione S-transferase M3 (brain); Glutathione S-transferase Mu 3; glutathione S-transferase mu 3 (brain); glutathione S-transferase mu 3 (brain) GST5Mu-3 MGC3310 MGC3704 S-(hydroxyalkyl)glutathione lyase M3; glutathione S-transferase, Mu-3; GST class-mu 3; GSTM3-3; hGSTM3-3; S-(hydroxyalkyl)glutathione lyase M3
Gene Aliases: GST5; GSTB; GSTM3; GSTM3-3; GTM3
UniProt ID: (Human) P21266
Entrez Gene ID: (Human) 2947
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.