Novus Biologicals
Manufacturer Code:NBP155103
Catalog # NBP155103
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GSTM2(glutathione S-transferase M2 (muscle)) The peptide sequence was selected from the N terminal of GSTM2. Peptide sequence TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: glutathione S-alkyltransferase M2; glutathione S-aralkyltransferase M2; glutathione S-aryltransferase M2; glutathione S-transferase 4; glutathione S-transferase M1; glutathione S-transferase M2 (muscle); Glutathione S-transferase Mu 2; glutathione S-transferase mu 2 (muscle) MGC117303 muscle S-(hydroxyalkyl)glutathione lyase M2; GST class-mu 2; GST, muscle; GSTM2-2; S-(hydroxyalkyl)glutathione lyase M2
Gene Aliases: GST4; GSTM; GSTM2; GSTM2-2; GTHMUS
UniProt ID: (Human) P28161
Entrez Gene ID: (Human) 2946
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.