Novus Biologicals
Manufacturer Code:NBP214074
Catalog # NBP214074
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.5.1.18 glutathione S-alkyltransferase glutathione S-aralkyltransferase glutathione S-aryltransferase glutathione S-transferase M1 glutathione S-transferase mu 1 GST class-mu 1 GST HB subunit 4 GST1 GSTM1-1 GSTM1a-1a GSTM1b-1b GTH4 GTM1 H-B HB subunit 4 MGC26563 MU MU-1 S-(hydroxyalkyl)glutathione lyase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; glutathione S-transferase M1; Glutathione S-transferase Mu 1; GST class-mu 1; GST HB subunit 4; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; HB subunit 4; S-(hydroxyalkyl)glutathione lyase
Gene Aliases: GST1; GSTM1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; MU; MU-1
UniProt ID: (Human) P09488
Entrez Gene ID: (Human) 2944
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.