Novus Biologicals
Manufacturer Code:NBP157646
Catalog # NBP157646
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GSPT2 (G1 to S phase transition 2) The peptide sequence was selected from the middle region of GSPT2)(50ug). Peptide sequence GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: eRF3b ERF3BGST2 eukaryotic peptide chain release factor GTP-binding subunit ERF3B Eukaryotic peptide chain release factor subunit 3b FLJ10441 G1 to S phase transition 2 G1 to S phase transition protein 2 homolog; Eukaryotic peptide chain release factor GTP-binding subunit ERF3B; Eukaryotic peptide chain release factor subunit 3b; G1 to S phase transition protein 2 homolog
Gene Aliases: ERF3B; GSPT2; GST2
UniProt ID: (Human) Q8IYD1
Entrez Gene ID: (Human) 23708
Molecular Function: G-protein RNA binding protein enzyme modulator hydrolase nucleic acid binding translation elongation factor translation factor translation initiation factor translation release factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.