Novus Biologicals
Manufacturer Code:NBP179837
Catalog # NBP179837
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is GSG2. Peptide sequence SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11.1 germ cell associated 2 (haspin) Germ cell-specific gene 2 protein Haploid germ cell-specific nuclear protein kinase HASPIN H-haspin serine/threonine-protein kinase haspin; germ cell associated 2 (haspin); Germ cell-specific gene 2 protein; H-haspin; Haploid germ cell-specific nuclear protein kinase; Serine/threonine-protein kinase haspin
Gene Aliases: GSG2; HASPIN
UniProt ID: (Human) Q8TF76
Entrez Gene ID: (Human) 83903
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.