Novus Biologicals
Manufacturer Code:NBP256852
Catalog # NBP256852
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BOMMGC149294 Brother of mammalian grainyhead deafness autosomal dominant 28 DFNA28 FLJ13782 grainyhead-like 2 (Drosophila) grainyhead-like protein 2 homolog TFCP2L3MGC149295 Transcription factor CP2-like 3FLJ11172; Brother of mammalian grainyhead; grainyhead-like 2; Grainyhead-like protein 2 homolog; grainyhead-like transcription factor 2; Transcription factor CP2-like 3
Gene Aliases: BOM; DFNA28; ECTDS; GRHL2; TFCP2L3
UniProt ID: (Human) Q6ISB3
Entrez Gene ID: (Human) 79977
Molecular Function:
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.