Novus Biologicals
Manufacturer Code:NBP155175
Catalog # NBP155175
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GPT2(glutamic pyruvate transaminase (alanine aminotransferase) 2) The peptide sequence was selected from the C terminal of GPT2. Peptide sequence EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAT2 alanine aminotransferase 2 ALT2EC 2.6.1.2 Glutamate pyruvate transaminase 2 glutamic pyruvate transaminase (alanine aminotransferase) 2 Glutamic--alanine transaminase 2 glutamic-pyruvate transaminase 2 Glutamic--pyruvic transaminase 2 GPT 2; Alanine aminotransferase 2; ALT2; Glutamate pyruvate transaminase 2; glutamic pyruvate transaminase (alanine aminotransferase) 2; glutamic pyruvate transaminase 2; Glutamic--alanine transaminase 2; Glutamic--pyruvic transaminase 2; GPT 2
Gene Aliases: AAT2; ALT2; GPT 2; GPT2; MRT49
UniProt ID: (Human) Q8TD30
Entrez Gene ID: (Human) 84706
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.