Novus Biologicals
Manufacturer Code:NBP189110
Catalog # NBP189110
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAT1alanine aminotransferase 1 ALT1 ALT1EC 2.6.1.2 Glutamate pyruvate transaminase 1 glutamic-alanine transaminase 1 Glutamic--alanine transaminase 1 glutamic-pyruvate transaminase (alanine aminotransferase) Glutamic--pyruvic transaminase 1 GPT1GPT 1; alanine aminotransferase; Alanine aminotransferase 1; ALT1; Glutamate pyruvate transaminase 1; Glutamic--alanine transaminase 1; Glutamic--pyruvic transaminase 1; glutamic-alanine transaminase 1; glutamic-pyruvate transaminase (alanine aminotransferase); GPT 1
Gene Aliases: AAT1; ALT1; GPT; GPT1
UniProt ID: (Human) P24298
Entrez Gene ID: (Human) 2875
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.